Journal of Molecular Biology
Phosphorylation-dependent Conformational Transition of the Cardiac Specific N-Extension of Troponin I in Cardiac Troponin
Introduction
The Ca2+ -sensitive switch of cardiac sarcomeres has structural and functional properties that appear specialized for the regulation of the heartbeat. In both skeletal and cardiac muscle, the switch consists of troponin (Tn), a ternary complex of three proteins (TnC, TnT and TnI) and tropomyosin (Tm). Ca2+ binding to TnC signals a movement of Tm releasing the thin filament from a prevailing inhibition by TnT and TnI, and promoting strong force generating reactions of cross-bridges. Ca2+ signaling through cardiac TnC and transduction of the Ca2+ -binding signal through TnT and TnI differs significantly between cardiac and fast skeletal muscle. Although crystal structures of both isoforms of TnC show a dumbbell-shaped, highly helical protein, the N terminal lobe of cTnC has a single functional regulatory Ca2+ -binding site (site II), which triggers contraction,1., 2., [3] whereas fsTnC has two (site I and site II). Both cTnC and fsTnC have two active metal binding sites (sites III and IV) in the C-terminal lobe, which forms the core of the troponin complex throughout the contraction cycle.
Structural studies on the regulatory domains of skeletal and cardiac TnC reveal important differences in their conformational response to Ca2+ binding. Calcium binding at site I and site II of skeletal (sk)TnC results in an “opening” of the N-terminal regulatory domain via the concerted opening of the EF-hand motifs that exposes a hydrophobic cleft for binding of the switch region of skTnI.4., 5., 6. Calcium binding alone at site II of cTnC does not induce such an opening.[7], 8.
Troponin I, the inhibitory component of the troponin complex, make multiple Ca2+-dependent interactions with TnC, TnT, Tm, and actin. The inhibitory region, residues 137 to 148 (Figure 1), plays a central role in restraining Tm in a blocking position and comprises the minimum sequence necessary for inhibition of actomyosin Mg2+ATPase activity. Thus, the Ca2+-dependent switch between relaxation and contraction involves movement of the inhibitory region on actin-Tm. In the presence of Ca2+, the inhibitory region of cardiac (c)TnI is located alongside the linker region in cTnC.9., 10. Similarly, the inhibitory region of skTnI has recently been shown to lie alongside the interconnecting central helix of skTnC in the skeletal Tn complex.11., 12. In the absence of Ca2+, the inhibitory region of TnI moves away from TnC and interacts with actin.11., 13., [14], 15., 16., 17.
Cardiac TnI has an N-terminal extension of ∼27 to 33 residues containing two cAMP-dependent protein kinase A (PKA) phosphorylation sites, serine residues 23 and 24 in the mouse isoform (Figure 1).18 The phosphorylation motifs are adjacent to a conserved Xaa-Pro region (residues 12–18) of unknown function. In addition, a conserved acidic region is located proximal to the Xaa-Pro region (Figure 1).
Phosphorylation of the cardiac N-extension of cTnI, decreases the Ca2+-sensitivity of muscle contraction, increases the off-rate of Ca2+ dissociation from the regulatory domain of cTnC, increases relaxation and cross-bridge cycling, and contributes to the β-adrenergic agonist induced acceleration of cardiac relaxation (lusitropy).[19], 20., 21., 22., 23., 24.
We have shown that the cardiac N-extension interacts weakly with the N-lobe of cTnC and alters regulatory domain conformational substates, presumably toward more open/active conformations.25., 26., 27., 28. Residues 22 to 34 of the cardiac N-extension provide the primary binding region with the N-lobe of cTnC.29 Phosphorylation at Ser23/24 weakens interactions between the cardiac N- extension of cTnI and the N-lobe of cTnC.25., 27., 28., [30]
To further explore structural relationships within the cardiac specific N-extension, we have completed solution NMR studies and bioinformatics analyses on cTnI(1-32), cTnI(1-32) phosphorylated at Ser23/24 (cTnI(1-32)pp), and cTnI(1-32) having Ser23/24 substituted with Asp (cTnI(1-32)DD), a suitable stable mimetic for examining the structural and dynamic consequences of phosphorylation.27 We determined the structure of the bisphosphorylated form (at Ser23/24) and found evidence for a less structured N-extension in absence of bisphosphorylation. A model for the conformational transition, induced by bisphosphorylation, was obtained by docking the non-phosphorylated and bisphosphorylated cardiac specific N-extensions onto the core structure of cardiac troponin.31 A key feature of our model is that bisphosphorylation extends and stabilizes the C-terminal helix in the cardiac N-extension, weakening interactions with the N-lobe of cTnC and resulting in a bending of cTnI and positioning of the acidic N terminus for electrostatic interactions with the basic inhibitory region of cTnI. This model aids in understanding the modulation of myofilament sensitivity by phosphorylation.
Section snippets
Characterization of cTnI(1-32), cTnI(1-32)DD, and cTnI(1-32)pp
To explore structural relationships within the cardiac N-extension, solution NMR studies were carried out on cTnI(1-32), cTnI(1-32)pp, and cTnI(1-32)DD, having Ser23/24 replaced by Asp27. Natural abundance 1H-15N heteronuclear single-quantum coherence (HSQC) spectra for each of the three cTnI(1-32) peptides are shown in Figure 2. The increased dispersion observed in the 1H-15N spectrum of cTnI(1-32)pp results from increased chemical shift perturbations in residues 21–27 as a consequence of
Discussion
We present here the first atomic model for the phosphorylation-dependent conformational changes of cTnI, including the N-extension for which there is no atomic resolution data. NMR analyses show that residues 1–20 of the cardiac N-extension, containing the Xaa-Pro region and the conserved acidic N terminus, are not significantly affected by introduction of negative charge at Ser23/24 (Figure 2, Figure 3). These data indicate that the first 20 residues of the cardiac specific N-extension have
Peptides
Synthetic peptides cTnI(1-32) and cTnI(1-32)DD were synthesized by Protein Express (Cincinnati, OH) and the sequence confirmed by mass spectroscopy. The cTnI(1-32) peptide had the following sequence: MADESSDAAGEPQPAPAPVRRRSSANYRAYAT-NH2. The purity of the peptide was confirmed by HPLC. The phosphorylated cTnI(1-32) peptide, cTnI(1-32)pp, was synthesized at the Genetic Engineering Facility of the University of Illinois Biotechnology Center. The extent of phosphorylation at Ser23/24 was greater
Acknowledgements
This research was supported by the United States Department of Defense grant ARO MURI DAAD 19-02-1-0027 and National Institutes of Health grant HL83334 (to P.R.R.), National Institutes of Health grant PO1 HL062426 (Project 1) (to R.J.S.), National Institutes of Health grants AI055338 and GM067823 (to J.M.), and US Department of Energy, grant no. DE-FG02-05ER64026 and ARC Federation Fellowship FF0457488 (to J.T.). We are grateful to Dr Bret Abbott, Dr Geneviève, M. C. Gasmi-Seabrook and Ekram
References (76)
- et al.
The amino acid sequence of bovine cardiac tamponin-C. Comparison with rabbit skeletal troponin-C
Biochem. Biophys. Res. Commun.
(1975) - et al.
The calcium and magnesium binding sites on cardiac troponin and their role in the regulation of myofibrillar adenosine triphosphatase
J. Biol. Chem.
(1980) - et al.
Site-directed mutation of the trigger calcium-binding sites in cardiac troponin C
J. Biol. Chem.
(1989) - et al.
Structural details of a calcium-induced molecular switch: X-ray crystallographic analysis of the calcium-saturated N-terminal domain of troponin C at 1.75 Å resolution
J. Mol. Biol.
(1997) - et al.
Calcium binding to the regulatory domain of skeletal muscle troponin C induces a highly constrained open conformation
J. Mol. Biol.
(1998) - et al.
Conformation of the regulatory domain of cardiac muscle troponin C in its complex with cardiac troponin I
J. Biol. Chem.
(1999) - et al.
Cardiac troponin I inhibitory peptide: location of interaction sites on troponin C
FEBS Letters
(2000) - et al.
Calcium-dependent movement of troponin I between troponin C and actin as revealed by spin-labeling EPR
Biochem. Biophys. Res. Commun.
(2006) - et al.
The regulatory effects of tropomyosin and troponin I on the interaction of myosin loop regions with F-actin
J. Biol. Chem.
(2005) - et al.
A common motif of two adjacent phosphoserines in bovine, rabbit and human cardiac troponin I
FEBS Letters
(1990)
The effect of troponin I phosphorylation on the Ca2+-binding properties of the Ca2+-regulatory site of bovine cardiac troponin
J. Biol. Chem.
Phosphorylation of both serine residues in cardiac troponin I is required to decrease the Ca2+ affinity of cardiac troponin C
J. Biol. Chem.
Bisphosphorylation of cardiac troponin I modulates the Ca(2+)-dependent binding of myosin subfragment S1 to reconstituted thin filaments
FEBS Letters
In vivo and in vitro analysis of cardiac troponin I phosphorylation
J. Biol. Chem.
Regulatory domain conformational exchange and linker region flexibility in cardiac troponin C bound to cardiac troponin I
J. Biol. Chem.
NMR analysis of cardiac troponin C-troponin I complexes: effects of phosphorylation
FEBS Letters
Effects of troponin I phosphorylation on conformational exchange in the regulatory domain of cardiac troponin C
J. Biol. Chem.
Systematic mapping of regions of human cardiac troponin I involved in binding to cardiac troponin C: N- and C-terminal low affinity contributing regions
FEBS Letters
Left-handed polyproline helices commonly occur in globular proteins
J. Mol. Biol.
Structural consequences of cardiac troponin I phosphorylation
J. Biol. Chem.
Sequential phosphorylation of adjacent serine residues on the N- terminal region of cardiac troponin-I: structure-activity implications of ordered phosphorylation
FEBS Letters
Troponin-I interacts with the Met47 region of skeletal muscle actin. Implications for the mechanism of thin filament regulation by calcium
J. Mol. Biol.
A mutation in the N-terminus of troponin I that is associated with hypertrophic cardiomyopathy affects the Ca(2+)-sensitivity, phosphorylation kinetics and proteolytic susceptibility of troponin
J. Mol. Cell. Cardiol.
Novel sensors of the regulatory switch on the regulatory light chain of smooth muscle myosin
J. Biol. Chem.
Structural transition of the inhibitory region of troponin I within the regulated cardiac thin filament
Arch. Biochem. Biophys.
Altered regulatory properties of human cardiac troponin I mutants that cause hypertrophic cardiomyopathy
J. Biol. Chem.
The Xplor-NIH NMR molecular structure determination package
J. Magn. Reson.
Determination of three-dimensional structures of proteins from interproton distance data by dynamical simulated annealing from a random array of atoms. Circumventing problems associated with folding
FEBS Letters
Comparison of the crystal and solution structures of two RNA oligonucleotides
Biophys. J.
Protein secondary structure prediction based on position-specific scoring matrices
J. Mol. Biol.
Mechanism of direct coupling between binding and induced structural change in regulatory calcium binding proteins
Biochemistry
Calcium-induced structural transition in the regulatory domain of human cardiac troponin C
Biochemistry
Structure of the inhibitory region of troponin by site directed spin labeling electron paramagnetic resonance
Proc. Natl Acad. Sci. USA
Ca(2+)-regulated structural changes in troponin
Proc. Natl Acad. Sci. USA
The role of electrostatics in the interaction of the inhibitory region of troponin I with troponin C
Biochemistry
Calcium-induced movement of troponin-I relative to actin in skeletal muscle thin filaments
Science
Kinetics of the structural transition of muscle thin filaments observed by fluorescence resonance energy transfer
Biochemistry
The inhibitory region of troponin-I alters the ability of F-actin to interact with different segments of myosin
Eur. J. Biochem.
Cited by (80)
The lack of Troponin I Ser-23/24 phosphorylation is detrimental to in vivo cardiac function and exacerbates cardiac disease
2023, Journal of Molecular and Cellular CardiologyModulation of cardiac thin filament structure by phosphorylated troponin-I analyzed by protein-protein docking and molecular dynamics simulation
2022, Archives of Biochemistry and BiophysicsPhosphorylation of Troponin I finely controls the positioning of Troponin for the optimal regulation of cardiac muscle contraction
2021, Journal of Molecular and Cellular CardiologyFunctional communication between PKC-targeted cardiac troponin I phosphorylation sites
2017, Archives of Biochemistry and BiophysicsDiseases of Cardiac Sarcomeres
2017, Cardioskeletal Myopathies in Children and Young AdultsOrder–Disorder Transitions in the Cardiac Troponin Complex
2016, Journal of Molecular Biology